subtilosin A precursor(224) Protein Card

General Information
Name subtilosin A precursor
Sequence MKKAVIVENKGCATCSIGAACLVDGPIPDFEIAGATGLFG
LWG
Class Bacterial
Average Mass 4325.10
Monoisotopic Mass 4322.17
m/z M+H 4323.18
ProteinType Precursor
Parent
Organism Bacillus subtilis
Notes
Cyclic No

Assay
No assays found

References
Kawulka KE, Sprules T, Diaper CM, Whittal RM, McKay RT, Mercier P, Zuber P, Vederas JC (2004) Structure of Subtilosin A, a Cyclic Antimicrobial Peptide from Bacillus subtilis with Unusual Sulfur to a-Carbon Cross-Links: Formation and Reduction of a-Thio-a-Amino Acid Derivatives. Biochemistry 43:3385-95
Stein T, Dusterhus S, Stroh A, Entian KD (2004) Subtilosin production by two Bacillus subtilis subspecies and variance of the sbo-alb cluster. Appl Environ Microbiol 70:2349-53

Cross-references
Nucleic acids Bacillus subtilis subtilosin gene cluster, complete sequence
Structure
Links GenBank CAD23198.1
SwissProt O07623

Tools