Uberolysin precursor UblA(223) Protein Card

General Information
Name Uberolysin precursor UblA
Sequence MDILLELAGYTGIASGTAKKVVDAIDKGAAAFVIISIIST
VISAGALGAVSASADFIILTVKNYISRNLKAQAVIW
Class Bacterial
Average Mass 7781.18
Monoisotopic Mass 7776.33
m/z M+H 7777.34
ProteinType Precursor
Parent
Organism Streptococcus uberis
Notes
Cyclic No

Assay
No assays found

References
Wirawan RE, Swanson KM, Kleffmann T, Jack RW, Tagg JR (2007) Uberolysin: a novel cyclic bacteriocin produced by Streptococcus uberis. Microbiology 153:1619-30

Cross-references
Nucleic acids Streptococcus uberis PurH-like protein
Structure
Links GenBank ABG48503.1

Tools