SFTI precursor protein [partial+error](197) Protein Card

General Information
Name SFTI precursor protein [partial+error]
Sequence MATTMAKLITLVVLAILAFVEVSVSGYKTSISTITIEDNG
RCTKSIPPICFPDGRP
Class BBI-like trypsin inhibitor
Average Mass 5971.10
Monoisotopic Mass 5967.17
m/z M+H 5968.18
ProteinType Precursor
Parent
Organism Helianthus annus
Notes This sequence was shown to only be a partial sequence with N- and C- end errors (Mylne et al. Nat Chem Biol (2011) 7: 257-259)
Cyclic No

Assay
Platelet Aggregation
SFTI shows no inhibitory activity with integrin receptors [...]Mulvenna JP et al. (2005) J Biol Chem 280:32245-53

References
Mulvenna JP, Foley FM, Craik DJ. (2005) Discovery, structural determination, and putative processing of the precursor protein that produces the cyclic trypsin inhibitor sunflower trypsin inhibitor 1. J Biol Chem 280:32245-53

Cross-references
Nucleic acids
Structure Discovery, structural determination and processing of the precursor protein that produces the cyclic trypsin inhibitor SFTI-1
Links GenBank CAJ19097.1
SwissProt Q4GWU5

Tools