Viola baoshanensis cyclotide precursor 4(187) Protein Card

General Information
Name Viola baoshanensis cyclotide precursor 4
Sequence
MESNKKMQLVGFVLLAAFALPALAS
SFEKDVISPRAIQAV
LEKRGLSKLEDDPVLSALARTKTIISN
PVIEEALLNGANL
KAGN
GIPCAESCVWIPCTVTALLGCSCKDKVCYN
SLQTKY

Class Cyclotide
Average Mass 12828.10
Monoisotopic Mass 12819.73
m/z M+H 12820.74
ProteinType Precursor
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References

Cross-references
Domains Viba 12 (378)
Nucleic acids Viola baoshanensis cyclotide precursor 4 mRNA
Structure
Links GenBank ABI48959.1

Tools