cycloviolacin O25(185) Protein Card

General Information
Name cycloviolacin O25
Sequence DIFCGETCAFIPCITHVPGTCSCKSKVCYFN
Class Cyclotide
Average Mass 3363.92
Monoisotopic Mass 3361.42
m/z M+H 3362.43
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
No assays found

References
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12

Cross-references
Nucleic acids
Structure
Links SwissProt P85188

3D models Download or view with Jmol

Tools