cycloviolacin O19(179) Protein Card

General Information
Name cycloviolacin O19
Sequence GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
Class Cyclotide
Average Mass 3228.79
Monoisotopic Mass 3226.41
m/z M+H 3227.42
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
No assays found

References
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12

Cross-references
Nucleic acids
Structure
Links SwissProt P85182

3D models Download or view with Jmol

Tools