cycloviolacin O19(179) Protein Card

General Information
Name cycloviolacin O19
Sequence GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
Class Cyclotide
Technique MS,Amino acid analysis
Average Mass 3228.79
Monoisotopic Mass 3226.41
m/z M+H 3228.79
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
No assays found

References
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Slazak, B., Kapusta, M., Strömstedt, A.A., Słomka, A., Krychowiak, M., Shariatgorji, M., Andrén, P.E., Bohdanowicz, J., Kuta, E. and Göransson, U. (2018) How Does the Sweet Violet (Viola odorata L.) Fight Pathogens and Pests - Cyclotides as a Comprehensive Plant Host Defense System Frontiers in plant science 9:0-0

Cross-references
Nucleic acids
Structure
Links SwissProt P85182

3D models Download or view with Jmol

Tools