tricyclon precursor (partial)(173) Protein Card

General Information
Name tricyclon precursor (partial)
Sequence
MKTMASFVLVLVAAFALPAAFAS
LETKDVITRAAYEKLVE
SGAIQGITMTKTIISN
PILEEALVAHFNRKLG
GGTIFDCG
ESCFLGTCYTKGCSCGEWKLCYGTN
SLPESNNEKAMVASL
EKDVITRAAYENLVNSGAIQGITMTKTIISN
PILEEALVS
HFNRKLG
GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGEN

SLAI
Class Cyclotide
Average Mass 21820.23
Monoisotopic Mass 21805.76
m/z M+H 21806.77
ProteinType Precursor
Parent
Organism Viola tricolor
Notes
Cyclic No

Assay
No assays found

References
Mulvenna JP, Sando L, Craik DJ (2005) Processing of a 22 kDa Precursor Protein to Produce the Circular Protein Tricyclon A. Structure (Camb) 13:691-701

Cross-references
Domains tricyclon A (7)
tricyclon B (167)
Nucleic acids
Structure
Links

Tools