violacin A precursor(171) Protein Card

General Information
Name violacin A precursor
Sequence
MDAQKMKMVIGLVLVATTAFALMIPAASAV
DDFITRRAYD
NLVKSGAIKDIPVMAKTIISN
PVLEEGMLTYYTNKKLGD
S
AISCGETCFKFKCYTPRCSCSYPVCK
Class Cyclotide
Average Mass 11588.77
Monoisotopic Mass 11580.83
m/z M+H 11581.84
ProteinType Precursor
Parent
Organism Viola odorata
Notes linear cyclotidestop codon at end of sequence followed by NSLDN
Cyclic No

Assay
No assays found

References
Ireland DC, Colgrave ML, Nguyencong P, Daly NL, Craik DJ (2006) Discovery and characterization of a linear cyclotide from Viola odorata: implications for the processing of circular proteins. J Mol Biol 357:1522-35

Cross-references
Domains violacin A (172)
Nucleic acids violacin A precursor
Structure
Links SwissProt Q2HY54

Tools