vibe 2(1694) Protein Card

General Information
Name vibe 2
Sequence GIPCGESCVWIPCLTSAIGCSCSSKVCYKN
Class Cyclotide
Technique NGS
Average Mass 3085.61
Monoisotopic Mass 3083.31
m/z M+H 3085.61
ProteinType Wild type
Parent
Organism Viola betonicifolia
Notes
Cyclic Yes

Assay
No assays found

References
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U., Hettiarachchi,C.M. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Protein precursor(s) vibe 2 precursor [partial]
Nucleic acids
Structure
Links

Tools