Vodo L6(1683) Protein Card

General Information
Name Vodo L6
Sequence GIPCGESCVWIPCITGTIGCSCKSKVCYTN
Class Cyclotide
Average Mass 3099.64
Monoisotopic Mass 3097.33
m/z M+H 3099.64
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
No assays found

References
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0

Cross-references
Protein precursor(s) Vodo L6 precursor
Nucleic acids
Structure
Links

Tools