ribe33(1672) Protein Card

General Information
Name ribe33
Sequence GIPCGESCVYIPCTVTALLGCSCQDKVCYKN
Class Cyclotide
Technique MS,NGS
Average Mass 3244.79
Monoisotopic Mass 3242.4
m/z M+H 3244.79
ProteinType Wild type
Parent
Organism Rinorea bengalensis
Notes
Cyclic Yes

Assay
No assays found

References
Dang,T.T., Chan,L.Y., Tombling,B.J., Harvey,P.J., Gilding,E.K. and Craik,D.J. (2021) In Planta Discovery and Chemical Synthesis of Bracelet Cystine Knot Peptides from Rinorea bengalensis. J Nat Prod 84:395-407

Cross-references
Nucleic acids
Structure
Links

Tools