hyen CG(1592) Protein Card

General Information
Name hyen CG
Sequence SIPCGESCVYLPCFSAIFGCRCNEYSLCVKG
Class Cyclotide
Technique NGS
Average Mass 3343.89
Monoisotopic Mass 3341.42
m/z M+H 3343.89
ProteinType Wild type
Parent
Organism Hybanthus enneaspermus
Notes
Cyclic No

Assay
No assays found

References
Du,Q., Chan,L.Y., Gilding,E.K., Henriques,S.T., Condon,N.D., Ravipati,A.S., Kaas,Q., Huang,Y.H. and Craik,D.J. (2020) Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb <
i>
Hybanthus enneaspermus<
/i>
. J Biol Chem 295:10911-10925

Cross-references
Nucleic acids
Structure
Links

Tools