Hyfl P(156) Protein Card

General Information
Name Hyfl P
Sequence GSVPCGESCVWIPCISGIAGCSCKNKVCYLN
Class Cyclotide
Average Mass 3167.71
Monoisotopic Mass 3165.37
m/z M+H 3166.38
ProteinType Partial sequence
Parent
Organism Hybanthus floribundus W
Notes From mRNA
Cyclic Yes

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Protein precursor(s) Hyfl P precursor (partial)
Nucleic acids Hyfl P (partial)
Structure
Links

Tools