hyen AG(1541) Protein Card

General Information
Name hyen AG
Sequence GAMPCGESCVYIPCTVTALLGCSCKNNVCYKN
Class Cyclotide
Technique NGS
Average Mass 3318.89
Monoisotopic Mass 3316.4
m/z M+H 3318.89
ProteinType Wild type
Parent
Organism Hybanthus enneaspermus
Notes <i>H. enneaspermus</i>: some proteolytic fragments from full extract were sequenced by MS/MS (ProteinPilot) (Du et al., 2020).
Cyclic Yes

Assay
No assays found

References
Du,Q., Chan,L.Y., Gilding,E.K., Henriques,S.T., Condon,N.D., Ravipati,A.S., Kaas,Q., Huang,Y.H. and Craik,D.J. (2020) Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb <
i>
Hybanthus enneaspermus<
/i>
. J Biol Chem 295:10911-10925

Cross-references
Nucleic acids
Structure
Links

Tools