hyen R(1523) Protein Card

General Information
Name hyen R
Sequence AVPCGESCVWIPCITSIAGCSCSNKVCYMN
Class Cyclotide
Technique MS,NGS
Average Mass 3115.65
Monoisotopic Mass 3113.27
m/z M+H 3115.65
ProteinType Wild type
Parent
Organism Hybanthus enneaspermus
Notes <i>H. enneaspermus</i>: fully sequenced by MS/MS fragment matching (ProteinPilot) but could not be isolated from the plant for individual MS/MS sequencing (Du et al., 2020).
Cyclic Yes

Assay
No assays found

References
Du,Q., Chan,L.Y., Gilding,E.K., Henriques,S.T., Condon,N.D., Ravipati,A.S., Kaas,Q., Huang,Y.H. and Craik,D.J. (2020) Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb <
i>
Hybanthus enneaspermus<
/i>
. J Biol Chem 295:10911-10925

Cross-references
Nucleic acids
Structure
Links

Tools