Hyfl L(152) Protein Card

General Information
Name Hyfl L
Sequence GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
Class Cyclotide
Average Mass 3164.71
Monoisotopic Mass 3162.35
m/z M+H 3163.35
ProteinType Wild type
Parent
Organism Hybanthus floribundus W
Notes From mRNA
Cyclic Yes

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Protein precursor(s) Hyfl L precursor (partial)
Nucleic acids Hyfl L (partial)
Structure
Links GenBank ABB03999.1
SwissProt Q30CB2

3D models Download or view with Jmol

Tools