cT38(1516) Protein Card

General Information
Name cT38
Alternative name(s) ctr pep 13
Sequence KIPCGESCVWIPCFTSAFGCYCQSKVCYHS
Class Cyclotide
Technique MS,NGS
Average Mass 3347.92
Monoisotopic Mass 3345.43
m/z M+H 3346.44
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes acyclic
Cyclic No

Assay
No assays found

References
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Protein precursor(s) cT38 precursor [partial]
cT38 precursor [partial]
Nucleic acids
Structure
Links

Tools