Cter 29 precursor(1492) Protein Card

General Information
Name Cter 29 precursor
Alternative name(s) ctr pep 36 precursor
Sequence
MAYLRLVPLLVLFFFAASVNKTEA
GALCDERCTYVPCISA
ARGCSCNIHRVCSMN
HVIAATSKSI
DEHHLLCQSHEDCIT
KGTGNFCAPFLEHDVPYGWCFRAEAEGYLLKD
FLKIPKDI
LKKPIEITN
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Domains Cter 29 (1005)
Nucleic acids
Structure
Links GenBank MT468706

Tools