ctr pep 22 precursor(1471) Protein Card

General Information
Name ctr pep 22 precursor
Sequence IKNN
MASFRFAPLALIFIFALCVMFAVDNTEA
GSITGCGG
GCLLGRCYRPGCTCVRRICRRN
HIIAAEANTV
DDHHLLCE
SHDDCFKKGSGYYCAFFPDTNIHYGWCIYAESEGYKLKD
F
LETSINLEISMAITN
Class Cyclotide
Technique NGS
Average Mass 15053.32
Monoisotopic Mass 15043.15
m/z M+H 15044.15
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Domains ctr pep 22  (1440)
Nucleic acids
Structure
Links GenBank MT468689 

Tools