Hyfl D(144) Protein Card

General Information
Name Hyfl D
Sequence GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN
Class Cyclotide
Average Mass 3215.71
Monoisotopic Mass 3213.32
m/z M+H 3214.33
ProteinType Wild type
Parent
Organism Hybanthus floribundus E
Notes From mRNA
Cyclic Yes

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Protein precursor(s) Hyfl D precursor protein (partial)
Nucleic acids Hyfl D (partial)
Structure
Links GenBank ABB51616.1
SwissProt Q30C65

3D models Download or view with Jmol

Tools