Hyfl C(143) Protein Card

General Information
Name Hyfl C
Sequence GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
Class Cyclotide
Average Mass 3485.03
Monoisotopic Mass 3482.44
m/z M+H 3483.44
ProteinType Wild type
Parent
Organism Hybanthus floribundus E
Notes
Cyclic Yes

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Nucleic acids
Structure
Links GenBank P84649.1
SwissProt P84649

3D models Download or view with Jmol

Tools