vhl-2(138) Protein Card

General Information
Name vhl-2
Sequence GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
Class Cyclotide
Technique PcR
Average Mass 3175.56
Monoisotopic Mass 3173.23
m/z M+H 3175.56
ProteinType Wild type
Parent
Organism Viola hederacea
Notes
Cyclic Yes

Assay
No assays found

References
Chen B, Colgrave ML, Daly NL, Rosengren KJ, Gustafson KR, Craik DJ (2005) Isolation and characterisation of novel cyclotides from viola hederaceae: Solution structure and anti-HIV activity of VHL-1, a leaf-specific-expressed cyclotide. J Biol Chem 280:22395-405
Daly NL, Chen B, Nguyencong P, Craik DJ (2010) Structure and Activity of the Leaf-Specific Cyclotide vhl-2. Australian Journal of Chemistry 63:771-778

Cross-references
Nucleic acids
Structure Solution structure of vhl-2
Links SwissProt P85231

Tools