MCoTI-I(137) Protein Card

General Information
Name MCoTI-I
Alternative name(s) TI-1
Sequence GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
Class Squash trypsin inhibitor
Average Mass 3480.91
Monoisotopic Mass 3478.46
m/z M+H 3480.91
ProteinType Wild type
Parent
Organism Momordica cochinchinensis
Notes
Cyclic Yes

Assay
Protease inhibition
Open chain variants have reduced inhibitory activity against bovine trypsin compared to native cyclic proteins. [...]Avrutina O et al. (2005) Biol Chem 386:1301-6

References
Hernandez JF, Gagnon J, Chiche L, Nguyen TM, Andrieu JP, Heitz A, Trinh Hong T, Pham TT, Le Nguyen D (2000) Squash trypsin inhibitors from Momordica cochinchinensis exhibit an atypical macrocyclic structure. Biochemistry 39:5722-30
Thongyoo P, Jaulent AM, Tate EW, Leatherbarrow, RJ (2007) Immobilized protease-assisted sysnthesis of engineered cysteine-knot microproteins Chembiochem 8:1107-1109
Contreras,J., Elnagar,A.Y., Hamm-Alvarez,S.F. and Camarero,J.A. (2011) Cellular uptake of cyclotide MCoTI-I follows multiple endocytic pathways. J Control Release 155:134-143
Puttamadappa,S.S., Jagadish,K., Shekhtman,A. and Camarero,J.A. (2010) Backbone dynamics of cyclotide MCoTI-I free and complexed with trypsin. Angew. Chem. Int. Ed. Engl. 49:7030-7034

Cross-references
Protein precursor(s) TIPTOP1
TIPTOP2
Nucleic acids
Structure
Links GenBank 8928146|
SwissProt P82408

Tools