Proannomuricatin G(1352) Protein Card

General Information
Name Proannomuricatin G
Alternative name(s) PamG
Sequence RSEVPSLYLVMRGDSYSHHSSGLFLHLQLPNNE
MIGDYSY
P
AFVEDRRHLLSVSVDPYQV
Class Orbitide
Technique Genomic,PcR
ProteinType Precursor
Parent
Organism Annona muricata (guanabana)
Notes
Cyclic No

Assay
No assays found

References
Fisher, M.F., Zhang, J., Berkowitz, O., Whelan, J. and Mylne, J.S. (2020) Cyclic Peptides in Seed of Annona muricata Are Ribosomally Synthesized Journal of Natural Products. 83:1167-1173

Cross-references
Domains Annomuricatin G (1343)
Nucleic acids Proannomuricatin G
Structure
Links GenBank QEG99584.1

Tools