PLP-53 precursor(1330) Protein Card

General Information
Name PLP-53 precursor
Sequence
MAKVVVVALAMAAMILAFDEVAGY
TTTTTTTTEDN
GSRIW
VPGLGPVYEED
GLDN
RRGSCQIQIQELSHCQMHLTSPSFD
YR
LRMAVEN
PKQQQHLDLCCNQLRQVGEECQCEAIKQLVG
RQLQKKQGYGKQQVLEQIAKKAQMLSNQCNLQCSI
Class Orbitide
Technique Genomic
ProteinType Precursor
Parent
Organism Ratibida columnifera
Notes
Cyclic No

Assay
No assays found

References
Fisher, M.F., Payne, C.D., Rosengren, K.J. and Mylne, J.S. (2019) An orbitide from Ratibida columnifera seed containing 16 amino acid residues Journal of Natural Products 82:2152-2158

Cross-references
Domains PLP-53 (1328)
Nucleic acids PLP-53 precursor
Structure
Links GenBank QED39617.1

Tools