HB10(1314) Protein Card

General Information
Name HB10
Sequence GISCAETCVKLPCLSSVIGCTCQNKRCYKD
Class Cyclotide
Technique MS,PcR
Average Mass 3199.76
Monoisotopic Mass 3197.43
m/z M+H 3199.76
ProteinType Wild type
Parent
Organism Hedyotis diffusa
Notes
Cyclic Yes

Assay
Anti-bacterial
HB10 and HB11 were bactericidal to E. coli and Streptococcus salivarius at low micromolar concentration, and both had the reverse effect to bacterial drug resistance. [...]Wang et al. (2016) Int. J. Clin. Exp. Med 9:9521-9526

References
Wang, D., Chen, J., Zhu, J. and Mou, Y. (2016) Novel cyclotides from Hedyotis biflora has potent bactericidal activity against Gram-negative bacteria and E. coli drug resistance Int. J. Clin. Exp. Med 9:9521-9526

Cross-references
Nucleic acids
Structure
Links

Tools