ViulK(1291) Protein Card

General Information
Name ViulK
Sequence SIFCSETCRTFPCFTKAVGCSCVSKRCYKN
Class Cyclotide
Technique MS,Genomic
Average Mass 3363.93
Monoisotopic Mass 3361.47
m/z M+H 3363.93
ProteinType Wild type
Parent
Organism Viola uliginosa
Notes
Cyclic No

Assay
No assays found

References
Slazak, B., Jacobsson, E., Kuta, E. and Göransson, U. (2015) Exogenous plant hormones and cyclotide expression in Viola uliginosa (Violaceae Phytochemistry 117:527-536

Cross-references
Nucleic acids
Structure
Links

Tools