Viba35(1271) Protein Card

General Information
Name Viba35
Sequence GQDFCGGQICFASDCIVVGCECDAWSRCVPS
Class Cyclotide
Technique NGS,PcR
Average Mass 3250.63
Monoisotopic Mass 3248.27
m/z M+H 3250.63
ProteinType Wild type
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References
Zhang, J., Li, J., Huang, Z., Yang, B., Zhang, X., Li, D., Craik, D.J., Baker, A.J., Shu, W. and Liao, B. (2015) Transcriptomic screening for cyclotides and other cysteine-rich proteins in the metallophyte Viola baoshanensis. Journal of plant physiology 178:17-26

Cross-references
Nucleic acids
Structure
Links

Tools