Viba24(1260) Protein Card

General Information
Name Viba24
Alternative name(s) vibe 5
Sequence GKIPCGESCVWIPCITTVVGCSCSNKVCYKN
Class Cyclotide
Technique PcR,NGS
Average Mass 3268.86
Monoisotopic Mass 3266.45
m/z M+H 3268.86
ProteinType Wild type
Parent
Organism Viola baoshanensis
Viola betonicifolia
Notes
Cyclic Yes

Assay
No assays found

References
Zhang, J., Li, J., Huang, Z., Yang, B., Zhang, X., Li, D., Craik, D.J., Baker, A.J., Shu, W. and Liao, B. (2015) Transcriptomic screening for cyclotides and other cysteine-rich proteins in the metallophyte Viola baoshanensis. Journal of plant physiology 178:17-26
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U., Hettiarachchi,C.M. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Protein precursor(s) Viba24 precursor
Nucleic acids
Structure
Links

Tools