Viba23(1259) Protein Card

General Information
Name Viba23
Sequence GIPCGESCVWIPCFSAAIGCSCSSKVCYRN
Class Cyclotide
Technique NGS,PcR
Average Mass 3117.61
Monoisotopic Mass 3115.29
m/z M+H 3117.61
ProteinType Wild type
Parent
Organism Viola baoshanensis
Notes
Cyclic Yes

Assay
No assays found

References
Zhang, J., Li, J., Huang, Z., Yang, B., Zhang, X., Li, D., Craik, D.J., Baker, A.J., Shu, W. and Liao, B. (2015) Transcriptomic screening for cyclotides and other cysteine-rich proteins in the metallophyte Viola baoshanensis. Journal of plant physiology 178:17-26

Cross-references
Nucleic acids
Structure
Links

Tools