MCoTI-15(1229) Protein Card

General Information
Name MCoTI-15
Sequence GGACPRILKQCRRDSDCPGACVCQGNGYCGSGSD
Class Squash trypsin inhibitor
Technique MS,PcR
Average Mass 3410.77
Monoisotopic Mass 3408.37
m/z M+H 3410.77
ProteinType Wild type
Parent
Organism Momordica subangulata
Notes
Cyclic Yes

Assay
No assays found

References
Mahatmanto, T., Mylne, J.S., Poth, A.G., Swedberg, J.E., Kaas, Q., Schaefer, H. and Craik, D.J. (2015) The evolution of Momordica cyclic peptides. Molecular biology and evolution 32 2:392-405

Cross-references
Protein precursor(s) TIPTOP4
Nucleic acids
Structure
Links

Tools