Modi 2(1228) Protein Card

General Information
Name Modi 2
Alternative name(s) MCoTI-14
Sequence GGACPKILQKCRRDSDCPGACVCQGNGYCGSGSD
Class Squash trypsin inhibitor
Technique MS,Genomic,PcR
Average Mass 3382.76
Monoisotopic Mass 3380.37
m/z M+H 3382.76
ProteinType Wild type
Parent
Organism Momordica dioica
Momordica subangulata
Notes
Cyclic Yes

Assay
No assays found

References
Du J, Chan LY, Poth AG, Craik DJ (2019) Discovery and Characterization of Cyclic and Acyclic Trypsin Inhibitors from Momordica dioica. J Nat Prod. 82:293-300
Mahatmanto, T., Mylne, J.S., Poth, A.G., Swedberg, J.E., Kaas, Q., Schaefer, H. and Craik, D.J. (2015) The evolution of Momordica cyclic peptides. Molecular biology and evolution 32 2:392-405

Cross-references
Protein precursor(s) TIPTOP7
TIPTOP7
TIPTOP4
Nucleic acids
Structure
Links

Tools