TIPTOP4(1227) Protein Card

General Information
Name TIPTOP4
Sequence
MESKKILLVVLVAMMLVATSTC
FNDGDTTDLISDGRAQMD
IN
GGACPKILQRCRRDSDCPSACICRGNGYCGSGSD
AIDL
ISDSRAQIDIN
GGACPKILQKCRRDSDCPGACVCQGNGYC
GSGSD
ALDLMSDGRAQIDIN
GGACPRILKQCRRDSDCPGA
CVCQGNGYCGSGSD
ALDLMSDGRAQIGIN
GGACPRILKQC
RRDSDCPGACICQGNGYCGSGSD
ALDLMSDGRAQIDIN
GG
ACPRILKKCRRDSDCPGACVCRGNGYCGSGSD
ALDLMSDG
RAQIDIN
GGACPRILKKCRRDSDCPGACVCQGNGYCGSGS
D
MIDLISDGGAQTGEDINGGGVYDKR
QRACPRILKKCRRD
SDCPGECICQGNGYCG
Class Squash trypsin inhibitor
Technique PcR
ProteinType Precursor
Parent
Organism Momordica subangulata
Notes
Cyclic No

Assay
No assays found

References
Mahatmanto, T., Mylne, J.S., Poth, A.G., Swedberg, J.E., Kaas, Q., Schaefer, H. and Craik, D.J. (2015) The evolution of Momordica cyclic peptides. Molecular biology and evolution 32 2:392-405

Cross-references
Domains MCoTI-13 (1226)
Modi 2 (1228)
MCoTI-15 (1229)
MCoTI-16 (1230)
Modi 4 (1231)
MCoTI-IV (796)
MCoTI-VI (795)
Nucleic acids
Structure
Links

Tools