MCoTI-HA(1209) Protein Card

General Information
Name MCoTI-HA
Sequence GGVCPKILQRCRRDSDCPGACICRGNGYCGYPYDVPDYA
Class Cyclotide
Technique MS
Average Mass 4218.76
Monoisotopic Mass 4215.81
m/z M+H 4218.76
ProteinType Grafted
Parent MCoTI-I
Organism Synthetic
Notes MCoTI-HA was fused to a nanobody with affinity for antigen-presenting cells.
Cyclic Yes

Assay
No assays found

References
Kwon, S., Duarte, J.N., Li, Z., Ling, J.J., Cheneval, O., Durek, T., Schroeder, C.I., Craik, D.J. and Ploegh, H.L. (2018) Targeted delivery of cyclotides via conjugation to a nanobody ACS chemical biology 13:2973-2980

Cross-references
Nucleic acids
Structure Solution NMR structure of cyclotide MCoTI-HA
Links

Tools