cyI4(1206) Protein Card

General Information
Name cyI4
Sequence GNPGACGETCVWGKCYSASIGCSCNKYKVCTLN
Class Cyclotide
Technique MS
Average Mass 3393.86
Monoisotopic Mass 3391.4
m/z M+H 3393.86
ProteinType Wild type
Parent
Organism Viola inconspicua
Notes Sequence of cyI4 shares a novel “TLNGNPGA” motif in loop six with cyclotides cyI3,5,6. Isolated cyI4 demonstrated no killing at concentrations >60 μM against E. coli ATCC and K. pneumoniae.
Cyclic Yes

Assay
No assays found

References
Parsley, Nicole C., Patric W. Sadecki, Conrad J. Hartmann, and Leslie M. Hicks (2019) Viola “inconspicua” No More: An Analysis of Antibacterial Cyclotides Journal of natural products :0-0

Cross-references
Nucleic acids
Structure
Links

Tools