cyI3(1205) Protein Card

General Information
Name cyI3
Sequence GNPGACGETCIWGKCYSASIGCSCSKYKVCTLN
Class Cyclotide
Technique MS
Average Mass 3380.86
Monoisotopic Mass 3378.41
m/z M+H 3380.86
ProteinType Wild type
Parent
Organism Viola inconspicua
Notes Sequence of cyI3 shares a novel “TLNGNPGA” motif in loop six with cyclotides cyI4,5,6. Fractions predominantly containing cyclotides cyI3− cyI6 demonstrated an MIC of 18 μM and 35 μM against E. coli ATCC and K. pneumoniae, respectively. Isolated cyI3 killed ∼50% of E. coli at 60 μM.
Cyclic Yes

Assay
No assays found

References
Parsley, Nicole C., Patric W. Sadecki, Conrad J. Hartmann, and Leslie M. Hicks (2019) Viola “inconspicua” No More: An Analysis of Antibacterial Cyclotides Journal of natural products :0-0

Cross-references
Nucleic acids
Structure
Links

Tools