cyI2(1204) Protein Card

General Information
Name cyI2
Sequence GTFPCGESCVWIPCISSVVGCSCKSKVCYKN
Class Cyclotide
Technique MS
Average Mass 3261.83
Monoisotopic Mass 3259.41
m/z M+H 3261.83
ProteinType Wild type
Parent
Organism Viola inconspicua
Notes The sequence of cyI2 shares “GTXPCGE” motif with cyI1.
Cyclic Yes

Assay
No assays found

References
Parsley, Nicole C., Patric W. Sadecki, Conrad J. Hartmann, and Leslie M. Hicks (2019) Viola “inconspicua” No More: An Analysis of Antibacterial Cyclotides Journal of natural products :0-0

Cross-references
Nucleic acids
Structure
Links

Tools