circularin A precursor protein(120) Protein Card

General Information
Name circularin A precursor protein
Sequence MFLVAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIAS
GGAGTLMTIGWATFKATVQKLAKQSMARAIAY
Class Bacterial
Average Mass 7180.59
Monoisotopic Mass 7175.98
m/z M+H 7176.99
ProteinType Precursor
Parent
Organism Clostridium beijerinckii
Notes
Cyclic No

Assay
No assays found

References
Kemperman R, Kuipers A, Karsens H, Nauta A, Kuipers O, Kok J (2003) Identification and characterization of two novel clostridial bacteriocins, circularin A and closticin 574. Appl Environ Microbiol 69:1589-97
Kemperman R, Jonker M, Nauta A, Kuipers OP, Kok J (2003) Functional analysis of the gene cluster involved in production of the bacteriocin circularin A by Clostridium beijerinckii ATCC 25752. Appl Environ Microbiol 69:5839-48

Cross-references
Nucleic acids circularin A precursor gene
Structure
Links GenBank AAN86036.1
SwissProt Q8GB47

Tools