Vpub C(1194) Protein Card

General Information
Name Vpub C
Sequence GIIPCGESCVFIPCITSIVGCSCKSKVCYKN
Class Cyclotide
Technique MS
Average Mass 3228.88
Monoisotopic Mass 3226.48
m/z M+H 3228.88
ProteinType Wild type
Parent
Organism Viola pubescens
Notes
Cyclic Yes

Assay
No assays found

References
Ravipati AS, Poth AG, Troeira Henriques S, Bhandari M, Huang YH, Nino J, Colgrave ML, Craik DJ. (2017) Understanding the Diversity and Distribution of Cyclotides from Plants of Varied Genetic Origin. J Nat Prod. 80:1522-1530

Cross-references
Nucleic acids
Structure
Links

Tools