gassericin A precursor protein(118) Protein Card

General Information
Name gassericin A precursor protein
Sequence MVTKYGRNLGLNKVELFAIWAVLVVALLLTTANIYWIADQ
FGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWAL
AAAGALGATAA
Class Bacterial
Average Mass 9286.00
Monoisotopic Mass 9280.1
m/z M+H 9281.11
ProteinType Precursor
Parent
Organism Lactobacillus gasseri LA39
Notes
Cyclic No

Assay
No assays found

References
Kawai Y, Saito T, Toba T, Samant SK, Itoh T (1994) Isolation and characterization of a highly hydrophobic new bacteriocin (gassericin A) from Lactobacillus gasseri LA39. Biosci Biotechnol Biochem 58:1218-21
Kawai Y, Saito T, Kitazawa H, Itoh T (1998) Gassericin A
an uncommon cyclic bacteriocin produced by Lactobacillus gasseri LA39 linked at N- and C-terminal ends. Biosci Biotechnol Biochem 62:2438-40
Kawai Y, Saito T, Suzuki M, Itoh T (1998) Sequence analysis by cloning of the structural gene of gassericin A, a hydrophobic bacteriocin produced by Lactobacillus gasseri LA39. Biosci Biotechnol Biochem 62:887-92

Cross-references
Nucleic acids Lactobacillus gasseri DNA for Gassericin A
Structure
Links GenBank BAA22261.1
SwissProt O24790

Tools