TIPTOP1(1168) Protein Card

General Information
Name TIPTOP1
Sequence MESKKLLPVVLVAMVLVATSTCFNDGYTTDLISDGRAQMD
IN
GGACPKILQRCRRDSDCPGACICRGNGYCGSGSD
AIDL
ISNGRAQIYIN
GGACPKILQKCRRDSDCPGACVCQGNGYC
GSGSD
ALDLISDGGAQIDIN
GGACPKILQKCRRDSDCPGA
CVCQGNGYCGSGSD
ALDLMSDGRAQIDIN
GGACPRILQKC
RRNSDCPSACVCQGNGYCGSGSD
ALDLMYDGRAQIDIN
GG
ACPRILKKCRRDSDCPGACVCRGNGYCGSGSD
ALDLMSDG
RAQIDIN
GGACPRILKKCRRDSDCPSACICQGNGYCGSGS
D
ALDLMSD
GGAQTGEDINGGGVYDEKQRVCPRILKKCRRD
SDCPGECICQGNGYCG
Class Squash trypsin inhibitor
ProteinType Precursor
Parent
Organism Momordica dioica
Notes
Cyclic No

Assay
No assays found

References
Du J, Chan LY, Poth AG, Craik DJ (2019) Discovery and Characterization of Cyclic and Acyclic Trypsin Inhibitors from Momordica dioica. J Nat Prod. 82:293-300

Cross-references
Domains Modi 1 (1161)
Modi 2 (1162)
Modi 2 (1162)
Modi 3 (1163)
Modi 4 (1166)
Modi 5 (1164)
Modi 6 (1167)
Nucleic acids Momordica dioica two inhibitor peptide topologies precursor 1 gene, complete cds
Structure
Links GenBank QAV57572

Tools