Modi 2(1162) Protein Card

General Information
Name Modi 2
Sequence GGACPKILQKCRRDSDCPGACVCQGNGYCGSGSD
Class Squash trypsin inhibitor
Technique MS,Genomic
Average Mass 3382.76
Monoisotopic Mass 3380.37
m/z M+H 3382.76
ProteinType Wild type
Parent
Organism Momordica dioica
Notes
Cyclic Yes

Assay
No assays found

References
Du J, Chan LY, Poth AG, Craik DJ (2019) Discovery and Characterization of Cyclic and Acyclic Trypsin Inhibitors from Momordica dioica. J Nat Prod. 82:293-300

Cross-references
Protein precursor(s) TIPTOP1
TIPTOP1
Nucleic acids
Structure
Links

Tools