E.faecalis AS48 precursor protein(116) Protein Card

General Information
Name E.faecalis AS48 precursor protein
Sequence MVKENKFSKIFILMALSFLGLALFSASLQFLPIAHMAKEF
GIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAA
AGRESIKAYLKKEIKKKGKRAVIAW
Class Bacterial
Average Mass 11076.37
Monoisotopic Mass 11069.26
m/z M+H 11070.27
ProteinType Precursor
Parent
Organism Enterococcus faecalis
Notes
Cyclic No

Assay
No assays found

References
Martinez-Bueno M, Maqueda M, Galvez A, Samyn B, Van Beeumen J, Coyette J, Valdivia E (1994) Determination of the gene sequence and the molecular structure of the enterococcal peptide antibiotic AS-48. J Bacteriol 176:6334-9

Cross-references
Nucleic acids E.faecalis plasmid AS48 gene
Structure
Links GenBank CAA72917.1
SwissProt Q47765

Tools