hyen D(1139) Protein Card

General Information
Name hyen D
Sequence GFPCGESCVYIPCFTAAIGCSCKSKVCYKN
Class Cyclotide
Technique MS,NGS
Average Mass 3155.70
Monoisotopic Mass 3153.33
m/z M+H 3155.7
ProteinType Wild type
Parent
Organism Hybanthus enneaspermus
Notes <i>H. enneaspermus</i>: isolated from the plant and fully sequenced by MS/MS (Du et al., 2020).
Cyclic Yes

Assay
No assays found

References
Du,Q., Chan,L.Y., Gilding,E.K., Henriques,S.T., Condon,N.D., Ravipati,A.S., Kaas,Q., Huang,Y.H. and Craik,D.J. (2020) Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus. J Biol Chem 295:10911-10925
Du,Q., Huang,Y.H., Bajpai,A., Frosig-Jorgensen,M., Zhao,G. and Craik,D.J. (2020) Evaluation of the <
i>
in Vivo<
/i>
Aphrodisiac Activity of a Cyclotide Extract from <
i>
Hybanthus enneaspermus<
/i>
. J Nat Prod :0-0

Cross-references
Nucleic acids
Structure
Links GenBank C0HLN8

Tools