hyen D(1139) Protein Card

General Information
Name hyen D
Sequence GFPCGESCVYIPCFTAAIGCSCKSKVCYKN
Class Cyclotide
Technique MS,NGS
Average Mass 3155.70
Monoisotopic Mass 3153.33
m/z M+H 3155.7
ProteinType Wild type
Parent
Organism Hybanthus enneaspermus
Notes <i>H. enneaspermus</i>: isolated from the plant and fully sequenced by MS/MS (Du et al., 2020).
Cyclic Yes

Assay
No assays found

References
Du,Q., Chan,L.Y., Gilding,E.K., Henriques,S.T., Condon,N.D., Ravipati,A.S., Kaas,Q., Huang,Y.H. and Craik,D.J. (2020) Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb <
i>
Hybanthus enneaspermus<
/i>
. J Biol Chem 295:10911-10925
Du,Q., Huang,Y.H., Bajpai,A., Frosig-Jorgensen,M., Zhao,G. and Craik,D.J. (2020) Evaluation of the <
i>
in Vivo<
/i>
Aphrodisiac Activity of a Cyclotide Extract from <
i>
Hybanthus enneaspermus<
/i>
. J Nat Prod :0-0

Cross-references
Nucleic acids
Structure
Links GenBank C0HLN8

Tools