caripe 11(1134) Protein Card

General Information
Name caripe 11
Sequence GVIPCGESCVFIPCISTVIGCSCKKKVCYRN
Class Cyclotide
Technique MS
Average Mass 3283.96
Monoisotopic Mass 3281.53
m/z M+H 3283.96
ProteinType Wild type
Parent
Organism Carapichea ipecacuanha
Notes Sequence confirmed by MS (Fahradpour et al)
Cyclic Yes

Assay
No assays found

References
Fahradpour, M., Keov, P., Tognola, C., Perez-Santamarina, E., McCormick, P.J., Ghassempour, A. and Gruber, C.W. (2017) Cyclotides Isolated from an Ipecac Root Extract Antagonize the Corticotropin Releasing Factor Type 1 Receptor Frontiers in pharmacology 8:616-0

Cross-references
Nucleic acids
Structure
Links

Tools