caripe 10(1133) Protein Card

General Information
Name caripe 10
Sequence GVIPCGESCVFIPCFSTVIGCSCKNKVCYRN
Class Cyclotide
Technique MS,Amino acid analysis
Average Mass 3303.91
Monoisotopic Mass 3301.47
m/z M+H 3303.91
ProteinType Wild type
Parent
Organism Carapichea ipecacuanha
Notes Sequence confirmed by MS + amino acid analysis.
Cyclic Yes

Assay
No assays found

References

Cross-references
Nucleic acids
Structure
Links

Tools