cT38(1101) Protein Card

General Information
Name cT38
Sequence KIPCGESCVWIPCFTSAFGCYCQSKVCYHS
Class Cyclotide
Technique NGS
Average Mass 3341.88
Monoisotopic Mass 3339.39
m/z M+H 3341.88
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Lacks C-terminal N or E required for cyclisation.
Cyclic No

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0

Cross-references
Protein precursor(s) cT38 precursor
Nucleic acids cT38 mRNA (partial)
Structure
Links GenBank AML32997.1
SwissProt A0A126TRL7

Tools