Cter 31 precursor (partial)(1059) Protein Card

General Information
Name Cter 31 precursor (partial)
Sequence DNLNQKMAYLRLFTLAAVIFFFAASVEKTKA
DLQCAETCV
HSPCIGPCYCKHGVICYKN
HVIAAAAKSVNDYYLLCQSHE
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Domains Cter 31 (1007)
Nucleic acids Cter 31 mRNA partial
Structure
Links GenBank ALL96764
SwissProt A0A0S1RSY3

Tools