Cter 13 precursor(1049) Protein Card

General Information
Name Cter 13 precursor
Sequence MASFRFAPLALIFIFAICVMFAVHNTEA
GSAIRCGERCLL
GRCHRPGCTCIRRICRRN
HVIAAEANTVDDHHLLCESHED
CFKKGSGNYCAFFPDTNIHYGWCFNAESEGYMLKDFLETS
IKDNLEIPMAITN
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Domains Cter 13 (997)
Nucleic acids Cter 13 mRNA
Structure
Links GenBank ALL96744
SwissProt A0A0S1RQI2

Tools