Cter 2 precursor (partial)(1039) Protein Card

General Information
Name Cter 2 precursor (partial)
Sequence VKKTEG
GDPLKCGESCFAGKCYTPGCTCEYPICMNN
HIIA
LDAKTMDQHRLLCESHEDCLKKRTGNYCAPFPDSDIHFGW
CFHAESEGYLLKDFLKMSKDDLKMPTEITN
Class Cyclotide
Technique NGS
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic No

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Domains Cter 2 (987)
Nucleic acids Cter 2 mRNA partial
Structure
Links GenBank ALL96749
SwissProt A0A0S1RRY1

Tools